General Information

  • ID:  hor006931
  • Uniprot ID:  P10145??22-99)
  • Protein name:  MDNCF-a
  • Gene name:  PTN
  • Organism:  Homo sapiens
  • Family:  Intercrine alpha (chemokine CxC) family
  • Source:  Human
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human)
  • GO MF:  GO:0005576 extracellular region; GO:0005615 extracellular space
  • GO BP:  GO:0005153 interleukin-8 receptor binding; GO:0008201 heparin binding; GO:0045236 CXCR chemokine receptor binding; GO:0008009 chemokine activity
  • GO CC:  GO:0007165 signal transduction; GO:0002237 response to molecule of bacterial origin; GO:0034976 response to endoplasmic reticulum stress; GO:0045091 regulation of single stranded viral RNA replication via double stranded DNA intermediate; GO:0030155 regulation of cell adhesion; GO:0090023 positive regulation of neutrophil chemotaxis; GO:0010628 positive regulation of gene expression; GO:0031328 positive regulation of cellular biosynthetic process; GO:0045766 positive regulation of angiogenesis; GO:0042119 neutrophil activation; GO:0010629 negative regulation of gene expression; GO:0031623 receptor internalization; GO:2000535 regulation of entry of bacterium into host cell; GO:0008285 negative regulation of cell population proliferation; GO:0001525 angiogenesis; GO:0061844 antimicrobial humoral immune response mediated by antimicrobial peptide; GO:0019722 calcium-mediated signaling; GO:0044344 cellular response to fibroblast growth factor stimulus; GO:0045744 negative regulation of G pr

Sequence Information

  • Sequence:  GAVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS
  • Length:  78
  • Propeptide:  MTSKLAVALLAAFLISAALCEGAVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS
  • Signal peptide:  MTSKLAVALLAAFLISAALC
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    NA

Physical Information

Mass: Formula:
Absent amino acids: Common amino acids:
pI: Basic residues:
Polar residues: Hydrophobic residues:
Hydrophobicity: Boman Index:
Half-Life: Half-Life Yeast:
Half-Life E.Coli: Aliphatic Index
Instability Index: Extinction Coefficient cystines:
Absorbance 280nm:

Literature

  • PubMed ID:  NA
  • Title:  NA